Find Jobs
Hire Freelancers

Neuro fuzzy systems

$30-250 USD

Closed
Posted over 7 years ago

$30-250 USD

Paid on delivery
I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.
Project ID: 11760381

About the project

9 proposals
Remote project
Active 8 yrs ago

Looking to make some money?

Benefits of bidding on Freelancer

Set your budget and timeframe
Get paid for your work
Outline your proposal
It's free to sign up and bid on jobs
9 freelancers are bidding on average $317 USD for this job
User Avatar
sir i can help u with this project i have done masters in computer engg with specilization in image processing and pattern recognition this is a dummy bid i can give u an exact estimate after we discuss the project hopping for your kind consideration
$155 USD in 3 days
4.9 (102 reviews)
6.1
6.1
User Avatar
Hi i can help you in this project. I have done projects on fuzzy logic. kindly share some more details so that i can further guide you. Thanks for considering my bid.
$222 USD in 7 days
4.9 (15 reviews)
4.9
4.9
User Avatar
I am an expert in data mining and predictive modeling. I have a PhD in Physics and I have extensive experience in machine learning applications, statistics and software development (web, mobile, desktop, SaaS). I work with R, Python, Spark, SQL, noSQL, Hadoop, .NET, Java, Angular JS, Quantopian, C#, and Tableau.
$800 USD in 12 days
5.0 (5 reviews)
4.4
4.4
User Avatar
Hi! Im an electrical and electronic masters student studying in UWE. I have the experience of programming in C/C++/Assembly/Arduino/PIC C/MikroC/MATLAB for more than three years. I also have the knowledge and experience of ELECTRICAL AND ELECTRONICS circuit analysis and design. I also have experience in embedded systems using microcontrollers like PIC, ATMEL, ARDUINO and most of the other types. I have made different kinds of devices varying from radios to drones and more. I am very keen to work on implementation projects I also have studied Artificial intelligence. Im very thorough with subjects like Neural networks, Fuzzy systems, Genetic algorithms and Expert Systems. I have done BCS (British computer society) diploma level. I have the knowledge on PHP/HTML5/mySQL for website development. I have completed many freelancer assignments successfully. If you are interested in hiring me, please send me a message. I have made a lot of reports in the recent past. I have good experience in using Microsoft office softwares like Word, Excel and Powerpoint. I can write reports of any length without mistakes. Thank you!
$135 USD in 2 days
4.6 (14 reviews)
4.0
4.0
User Avatar
Hi, I have read and understood the project description and possess the skills required to meet your needs. Please give me a chance and reply. Thanks.
$833 USD in 10 days
4.0 (6 reviews)
4.0
4.0
User Avatar
I have M.Sc. in engineering and more than 10 years of experience as an engineer and researcher. More than 40 papers, seven books, and one standard. In my profile, I attached some of my papers and books and samples of my previous projects in Freelancer. I am professional in your task, and I can complete your project on time, but first, I need to know more about your task. The most important thing for me in Freelancer is to do the clients projects correct and in time. I look forward to hearing from you!
$200 USD in 7 days
5.0 (1 review)
2.0
2.0
User Avatar
Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Processing, wireless sensor network, routing protocol, electrical & electronics engineering and communication system.
$155 USD in 3 days
0.0 (0 reviews)
0.0
0.0
User Avatar
Hello, I can do this project. I am expert in Matlab. I have done no of project on Matlab. Please open your chat box for more discussion. Area of Interest: Image Processing, Speech & Pattern reorganization, Signal Processing, wireless sensor network, routing protocol, electrical & electronics engineering and communication system.
$155 USD in 3 days
0.0 (0 reviews)
0.0
0.0

About the client

Flag of UNITED STATES
Dover, United States
1.0
1
Member since Sep 19, 2016

Client Verification

Thanks! We’ve emailed you a link to claim your free credit.
Something went wrong while sending your email. Please try again.
Registered Users Total Jobs Posted
Freelancer ® is a registered Trademark of Freelancer Technology Pty Limited (ACN 142 189 759)
Copyright © 2024 Freelancer Technology Pty Limited (ACN 142 189 759)
Loading preview
Permission granted for Geolocation.
Your login session has expired and you have been logged out. Please log in again.